- NK3R/TACR3/Neurokinin B Receptor Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82561
- Human
- NK3R/TACR3/Neurokinin B Receptor
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: MATLPAAETW IDGGGGVGAD AVNLTASLAA GAATGAVETG WLQLLDQAGN LSSSPSALGL PVASPAPSQP WANLTNQFVQ PSWRIALWS
- NK3R, NKR, NK3, HH11, TAC3RL, TAC3R, NK-3R
- Unconjugated
- Rabbit
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- tachykinin receptor 3
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- GPCR
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWS
Specifications/Features
Available conjugates: Unconjugated